Ochiltree county jail records. Other Jails & Prisons Nearby.
Ochiltree county jail records Elections. Deposit Money for an Inmate in the Ochiltree County Jail **Call 806-435-8000 first to ask Ochiltree County Jail if this option is still available. JAIL EXCHANGE. You can call them anytime for inmate information at 806-435-8000. Clicking on any of the Ochiltree County or city facilities below will direct you to an information page with Inmate Search, Visitation, Mail, Phone, Email, Court cases, Looking for Ochiltree County Jail inmates, mugshots & criminal records? Quickly find Jail & Prison phone number, directions & records (Perryton, TX). Courts; District Attorney Offices; Fire Departments; Hospitals; Jails It is provided by the TDCJ and allows you to view the arrest records of all current Ochiltree County prisoners. Eusebio James, 21, was arrested for possession of a controlled substance. Title VI. It serves as a valuable resource for individuals interested in checking their own arrest records, as well as for employers, landlords, and other parties seeking to screen potential candidates or tenants. There were two arrests on Tuesday, October 8. Use our directory to access the Ochiltree County Sheriff's Office website for online criminal records, background checks, and verification. For details, scroll below or call the Ochiltree County Jail Report. net Get free Ochiltree County Court Records from 3 Courts in Ochiltree County, TX and 4 official Court record directories. 2019; 2018; 2017; 2016; 2015; Spearman ISD TNT Worksheets. Business Hours. Contact Info. We highly recommend that you call 806-435-8000 first for any changes due to staff shortages or other unforeseen circumstances, including whether your inmate has become Looking for police, arrests, warrants & records in Ochiltree County, TX? Quickly access services from 2 Police Departments near you! Jail Records; Police Records; Sex Offender Registries; Warrants; All Ochiltree County Public Records; Ochiltree County Government Offices. org Ochiltree County a reputable private company, offers access to arrest records from various locations across the United States. Johnson Estate, Thelma Faye. Use Search Parameters: You can search Search for Inmates on the Jail Roster in Ochiltree County Texas. There was one arrest on Friday, July 8. Jason Ray Gonzales, 49, was arrested for aggravated assault with a deadly weapon. Find out their bond, and 5. E. Most recent Ochiltree County Bookings Texas. đđŽââď¸ Ector County Jail Information. Reviewthe Jail Roster 2. There was one arrest on Saturday, February 19. Ochiltree County Incarceration Statistics. In Ochiltree County, and across Texas, Search for inmates incarcerated in Ochiltree County Jail, Perryton, Texas. The Spearman Police Department usually manages a jail roster that catalogs all the jail inmates presently held in their temporary holding facility. Important Taxpayer Information. At-home and onsite video visitation guidelines for Ochiltree County Jail, when this service is available, can be found by going to the visitation information page. The jail has an inmate capacity of 1000. Access child support warrants, jury duty information, and various court forms, including those for family court, small claims, and restraining orders. McCulloch County Sheriffâs Office Open Records Request. We have not found any records/reports on the McCulloch County Sheriffâs Office. Page (post) titleHomePage (post) title INMATE SEARCH INMATE VISITATION JAIL PROGRAMS SEARCH INMATE DATABASE 400-12. Our mission is to provide a reliable, efficient, and secure platform for friends, family, and concerned citizens to access critical information about incarcerated individuals in Ochiltree County and across the state of Texas. The county was formed in 1889 and named after W. Main Street, Suite #8 Perryton, TX 79070 Phone: 806-435-8039 Fax: 806-435-2081. jctxsheriff. Case & Jail Records Search . IMPORTANT - All remote visitation at the Ochiltree County Jail is conducted by City Tele Coin video. Jail records, court & arrest records, mugshots and even judicial reports. 6 miles The Ochiltree County Sheriff's Office, led by Sheriff Terry Bouchard, is located in Perryton, Texas, and is actively hiring TCOLE-certified Peace Officers for See the top Bail Bonds near Ochiltree County Jail, TX to help you get out of jail fast! Stuck in Jail. gov 500 E. Visitations Hours at Nueces Ochiltree County Jail Correctional Facility, located in the city of Perryton, Ochiltree County, Texas, is a highly secured jail that currently hosts thousands of inmates. Address: 511 S. To do that, you will need to be able to check the criminal history of the people you engage with on a daily basis. Instead we have included public records. If you cannot find the mugshot of the offender that has been arrested, it is because Ochiltree Cou Search for inmates incarcerated in Ochiltree County Jail, Perryton, Texas. Monday - Thursday. Central Bail Bonds II. Access jail rosters, booking details, release records, and mugshots. Overland El Paso, TX 79901 Phone: 915-546-2228 Parcel ID Sequence Account Owner ID Property Type Owner Name Address Property Address Legal Abstract Subdivision Lease Number Lease Name Agent Acres Market Value Persons indicated in these records are presumed innocent until proven guilty in a court of law. Welcome to Ochiltreecountyjail. How to find us. Ochiltree County Jail offender lookup: Warrant #, Criminal Records, Release Date, Sentenced On, Description, Bookings, Who's in jail, Inmate Roster, Degree Level, Post Date, Bond, Mugshots, Booking Date, Race, Arrests. Whether you need a marriage record, want to search for one, or need a marriage record application, you'll find it Tax rates and ultimately the amount of taxes levied on property are determined by governing bodies of each of the taxing authorities. As of 2010, the county has a population of 10,223. The City Secretaryâs Office is responsible for The Ochiltree County Jail, positioned at 21 SE 6th Street, Perryton, TX, 79070, operates as a primary Adult jail in Ochiltree County. Easily find free criminal records, free court records, free arrest records, free arrest warrants search, free corporation records, free divorce records, free marriage records, free property records, free death records 84th District Court - Ochiltree County 511 S. Gonzales (02/27/84) was arrested on a warrant for possession of drug paraphernalia and a warrant for displaying expired registration. 2019 I & S ; 2019 M & O ; 2018 I & S ; 2018 M & O ; 2017 I & S ; 2017 M & O ; 2016 I & S ; Ochiltree County Arrests: Mugshots & Inmate Records Ochiltree County, a hidden gem in the heart of Texas, is known for its rich history and vibrant community. County Administrative Policies To locate an inmate at Ochiltree County Jail, you can visit the Ochiltree County Sheriff's official website or contact the jail directly at the above phone number. CITY & COUNTY JAILS Inmate Search for Ochiltree County - Jails in Texas. Top Bail Bonds near Ochiltree County Jail, TX. Hansford County Jail Northwest Court Street, Spearman, TX - 25. tdcj Court Records in Ochiltree County (Texas) Explore Ochiltree County, Texas court records and resources. It is best to only use blue or black ink. Malaquias Vaquera, 20, was arrested for assault causes bodily injury - family violence. Inside and outside street view and aerial photos and videos. Records include Ochiltree County election results, election calendars & ballots, voter registrations, voting districts & precincts, polling place locations & more. If you need information on bonds, visitation, inmate calling, mail, inmate accounts, commissary or anything else, you can call the facility at (806) 435-8000 or send a fax at (806) 435-8011. Ochiltree County, Texas Overview. Viewtheir public mugshot in the roster. Your Results: Arrest Records, Mugshot, Charges, Facilit 1. 8:00 am - 5:00 pm. The HCSO has nearly 5,100 employees and 200 volunteer reservists dedicated to ensuring the safety of more than 4. This guide will help you navigate an inmate search, learn about the jail, and help you stay in To find out if someone you know has been recently arrested and booked into the Ochiltree County Jail, call the jailâs booking line at 806-435-8000. Francisco Javier Caro Jr. JAIL Exchange is the internet's most comprehensive FREE source for County Jail Inmate ADA Coordinator. Vendor Portal . However, Open records can be collected from the McCulloch County Clerkâs Office during Get FREE OCHILTREE COUNTY VOTER RECORDS & ELECTION RESULTS directly from 2 Texas gov't offices & 2 official voter records & election results databases. If the visit is taking place at the Ochiltree County Jail, whether in-person or by video, you will have to schedule the day and time with the jail. Email Ochiltree County Jail Report. Call 561-305-4895 for info exit_to_app Texas Online Records; Login. B. aspx. View and Search Recent Bookings and See Mugshots in Ochiltree County, Texas. The Ochiltree County Jail is in Texas. The county has a total area of 918 square miles, 918 square miles of which is land, and 0. If youâre trying to find prison statistics for Ochiltree County, you can consult this report by the TDCJ: https://www. Search for Ochiltree County criminal charges, police reports, jail mugshots, warrants, bookings, and other public records. You can visit your inmate at the jail, or from your own device or computer at home. 79070 Phone: 806-435-8020 Fax: 806-434-0421 Email: justiceofthepeace@ochiltree. Ochiltree County Jail is located at 21 SE 6th St, in Ochiltree, Texas and has the capacity of 32 beds. Postcards and envelopes MUST HAVE the sender's full name and return address on the envelope. There was one arrest on Tuesday, July 20. County Clerk RecordsQuickly access deeds, liens, oil & gas leases and title research with our free grantor-grantee and property search index. Ochiltree County Criminal Records. There were four arrests on Friday, March 26. Ochiltree County Jail Report. 2025 Budget Process. 2025 County Holidays. It is advisable to contact the Ochiltree County Jail before planning your visit by calling 806-435-8000. Family help. There were four arrests on Friday, March 18. 6 miles. The physical location of the Ector County Jail is: Ector County Jail 2500 US-385, Odessa, TX 79766 Phone: (432) 335-3060. Sheriff. Wheeler County Probation Department PO Box 1322, Canadian, TX - 40. Ash Perryton, TX 79070 Phone: 806-435-8000. Ochiltree County Jail Information. FIND A FACILITY. org, your premier online destination for locating individuals within Texasâs correctional facilities. Ochiltree County Sheriffs Office / Ochiltree County Jail 21 Southeast 6th Avenue Perryton, TX 79070 806-435-8000 Directions. Henderson County Jail is located in Henderson County, Texas. 701 SW 10th St Amarillo, TX 79101 Visit Website (806) 318-2149. Sitemap Marriage Records in Ochiltree County (Texas) Easily explore Ochiltree County marriage records. To search for an inmate in the Ochiltree County Jail, review their criminal charges, the amount of their bond, when they can get visits, or even view their mugshot, go to the Official Jail Inmate Access comprehensive information on Ochiltree Co Jail, including inmate search, visitation hours, rules, and contact details to stay connected with your loved ones Search Ochiltree County, TX jail records through our directory. Texas Inmate Search; Nationwide Inmate Records Online Check. There will be a Sheriff's Sale at 1 PM, March 4, 2025 regarding Cause No. It consists of 7 phases, 52 buildings with a total Show all | Hidden allContact UsContact Us Remarks: 1. Police initially said they arrested 20 men and 17 women, though Lo later upped the number to âat least 40. For those calling from places outside Hong Kong, please dial the area code "852" before the telephone number (not applicable to overseas offices). And families and friends of inmates at the Ochiltree County Jail can call at 806-435-8000 or fax at or fax806-435-8011. Roberts County Probation Department FIND INMATES, ARRESTS, WARRANTS & RECORDS FREE SEARCH. Ochiltree County is located in the state of Texas. The site is constantly being updated throughout the day! Locate and get visitation information for inmates incarcerated in Ochiltree County TX Jail, Texas by performing a quick Ochiltree County TX Jail inmate search with StateCourts! Ochiltree county inmate locator, search incarceration details in each individual public jail record. Main Street Perryton, TX 79070 Contact Information for Various Services: Airport - (806) 435-4226 Court Records for Misdemeanors - County Clerk Office - (806) 435-8039 Elections - County Clerk Office - (806) 435-8039 Ochiltree. As of the 2010 census, its population was 10,223. Postcards and envelopes MUST be mailed to the following address: Inmate's Full Name & Inmate ID# Ochiltree County Jail 511 S. Visitation hours, mugshots, prison roster, phone number, sending money and mailing address information. The Ochiltree County Sheriff's Office provides a video kiosk in the lobby Jail records, court & arrest records, mugshots and even judicial reports. The Sheriff, who is accountable for both maintaining operations and administrative tasks of the FIND INMATES, ARRESTS, WARRANTS & RECORDS FREE SEARCH. Osvaldo Berumen was arrested for possession of a controlled substance, DWI and unlawful carrying of a weapon. Eusebio James Vela, 18, was arrested for assault causes bodily injury and DWI. Ochiltree County Sheriff 21 SE 6th St. Depending on their charges, inmates may remain in custody Search for inmates incarcerated in Ochiltree County Jail, Perryton, Texas. Lookup Ochiltree County, TX arrest & inmate records. , Perryton, TX 79070 Phone (806)435-8000 Fax (806)435-8011 Ochiltree County Jail has its own methods for receiving money for inmates, and that information can be found above or by calling 806-435-8000 and asking, however most jails and prisons receive money for an inmateâs trust and commissary account, as well as an account used for communications, pretty much the same way. Start Date End Date; Full Index: 06/15/1909: 01/31/2025: Plat Maps: 01/01/1900: Henderson County Jail Information. This page offers links to key resources, including the county clerk's office, genealogy records, and marriage certificate requirements. The county seat is Perryton. Alexander E. Type an individualâs name and you will get results that Name Address Phone Fax; Ochiltree County Jail: 21 Southeast 6th Avenue Perryton, Texas, 79070: 806-435-8000: 806-435-8011: Read More: Perryton City Jail: 21 SE 2nd, Perryton, TX, 79070 Perryton, Texas, 79070: 806-435-4002 Search for free Ochiltree County, TX Criminal Records & Warrants, including Ochiltree County warrant searches, arrest records, police & sheriff records, most wanted lists, sex offender registries, and more. Ochiltree County Courthouse Mailing Address: 511 S. Find links to official resources for police reports, public records, pistol permits, restraining orders, Crime Stoppers, missing persons, and police job recruitment. Quick Links. Ochiltree County Clerk 511 S. This facility handles offenders arrested for misdemeanors and felonies, who are brought here for booking and processing. City & County Jails; traffic court records, court records, active arrest warrants and the warrant details, the offense description, and an accounting of all of their felony misdemeanor and sexual offenses. The jail can hold 667 inmates. WM Bucky Goldsberry 511 S. Nestled amidst picturesque landscapes, this charming county offers a perfect blend Nueces County Jail Information. These inmates have been convicted under the law of Texas state and according to the listed penalty, inmates who are 18+ are serving time in the Ochiltree County Jail for El Paso County Jail is located in El Paso County, Texas. Angel Uriel Rocha, 17, was arrested for possession of a controlled substance. 02 PREA Investigation Procedures This database is offered by the Fulton County Sheriffâs Office as a service to the public and members of the Fulton County justice system. First Name Criminal Records in Ochiltree County (Texas) Find essential criminal record information in Ochiltree County, TX. 1 million residents who call Harris County home. Get resources for sending money to inmates and learn about visitation schedules and guidelines. Hidalgo County LEPC. the Occupation date starts from September 1980. Abraham Rossel, 38, was arrested on two warrants for possession of a controlled substance - bond surrender. Amanda Manning, RAS 1391 HR-ADAAccessibility@epcountytx. Lipscomb County Probation Department PO Box 1322, Canadian, TX - 40. OCHILTREE COUNTY MARRIAGE RECORD Up-to-date Source of County Public and Vital Records: Home; Login; Contact; FAQs; Jail Exchange has Ochiltree County Arrests, Criminals, Courts, Laws and Most Wanted in Perryton, TX. Inmate Trust Account. . Sitemap The official county government website for Collin County to find government documents and services, and contact county elected officials, including elections, land records, jury duty, court cases, county sheriff, county jail, district attorney, Ochiltree County Jail Report. The physical location of the jail is: Ochiltree County Jail 21 SE 6th Ave, Perryton, TX 79070 Phone: (806) 435-8000. Hidalgo County Courthouse 100 North Closner. including Ochiltree County, TX bankruptcy, civil, probate, traffic, and criminal records, court case calendars, and dockets. We have not found any police records information on Perryton. This will direct you to a comprehensive database of inmates. Currently all of the Ochiltree County Records are scanned into the website, but they are only fully index back to July 1974, before that The Ochiltree County Jail also allows envelopes to be mailed to inmates. , 18, was arrested on a warrant for DWI - motion to revoke. Ochiltree County Jail. Ochiltree County Sherriff; Ochiltree County Arrest Info; Some of the cities, towns, and places in Ochiltree County are Booker, Farnsworth, Huntoon, Lipscomb County, Ochiltree, Perryton, Waka Ochiltree County ( OK-Él-tree) is a county located in the U. Attorneys; Bail Bonds; Home > Ochiltree County Jail, TX > Bail Bonds. Jesus Leyva Jr. Ochiltree County Jail Located in the city of Perryton, Ochiltree County, Texas, the Ochiltree County Jail is a 48-bed facility. Austin Lamm, 23, was arrested for evading arrest/detention on foot, possession of marijuana, and possession Access police records online in Ochiltree County, TX. â Those arrested were suspected of unlawful assembly and assaulting City One Shatin is located at 2 Tak Kei Street, City One / Shek Mun, New Territories. Use this website for informational purposes only. Ricardo Jose Gonzalez, 39, was arrested for possession of a controlled substance and DWI - court sentence. Ochiltree County Courthouse 511 S Main St Perryton, TX Perryton City Jail Basic Information Facility Name Perryton City Jail Facility Type City Jail Address 21 SE 2nd, Perryton, TX, 79070 Phone 806-435-4002 Ochiltree County Jail Remote Video Visitation Ochiltree County Jail Inmate Visitation. Ochiltree County Jail Details Type County Facility Inmate Capacity 32. Ector County Jail is located in Ector County, Texas. J Nieves Cavazos (09/02/86) was arrested for failure to id a fugitive/giving false information, a warrant for driving with Data and Records BUILDING TRUST THROUGH TRANSPARENCY. Ochiltree County TX Jail - Application process, dos and don'ts, visiting hours, rules, dress code. Visitation hours, prison roster, phone number, sending money and mailing address information. Helpful Links. Police Records Request in Perryton, Texas. The physical location of the El Paso County Jail is: El Paso County Jail 601. You can also send an email at txsheriff@ptsi. To find inmates, one can consult this jail roster either via the internet if the feature is available, or by making an inquiry over the phone 806-659-3708 or in person at the police station. Do a free background check here using free online public records searches in Ochiltree County. Maritza Naomi Uribe, 51, was arrested for Ochiltree County Jail Report. Ochiltree. Find reliable resources to stay informed about inmate Find complete inmate records for Ochiltree County, TX, including court records, arrest records, mugshots, and detailed inmate information. Luis Rosalino Ramirez, 30, was arrested on three warrants for forgery of a financial instrument and was being held as an illegal alien. Access the Inmate Roster: Visit the official Ochiltree County Jail Inmate Search Portal. Items that are NOT accepted by the jail include but are not limited to: Books, including torn Ochiltree County Jail Report. Look up court records, search court cases, and request court transcripts. The county sheriff's office can provide information on inmates currently held in the facility including their charges and Ochiltree County Sheriffs Office / Ochiltree County Jail South Ash Street, Perryton, TX - 31. net Ochiltree County Public Records; Ochiltree County Government Offices; Free Account Benefits: đ Unlock property owner names, sale prices, mortgage details 100% free - no credit card or payment needed đ Enjoy increased daily address searches đ Get free daily property unlocks Hansford County Probation Department South Main Street, Perryton, TX. There was one arrest on Wednesday, March 30. Get resources for sending money to inmates and If an inmate is arrested in Ochiltree County, Texas, they will most likely be at the Ochiltree County Jail awaiting their court date. Maxwell Road Peoria, IL 61604. 9 miles. Click the name What are the scheduled Inmate visitation times at the Ochiltree County Jail? The jail visitation times change often. Corpus Christi, TX 78401. Main St. Even though women are the fastest growing group of inmates in OCHILTREE County, men still make up the vast majority of inmates admitted to prison each year - nearly rate of 571 per 100,000 Ochiltree County, Texas free public records searches at Black Book Online. Email: countyclerk@ochiltree. state of Texas. org. Send an Email or Text to an Inmate in the Ochiltree County Jail The Ochiltree County Jail is or will soon be providing secure electronic messaging for their inmates. Search Ochiltree County jail and inmate records through Vinelink by offender id or name. All Bexar County Jail Activity Report data provided herein is provided free of charge by the Sheriff's Office as a courtesy to the citizens of Bexar County. City & County Jails FIND INMATES, ARRESTS, WARRANTS & RECORDS FREE SEARCH. This information will be unavailable periodically for general maintenance and regularly Ochiltree County Jail Report. There may be an automated method of Looking for Ochiltree County Sheriffs Office / Ochiltree County Jail inmates, records & auctions? Quickly find Sheriff phone number, directions & services (Perryton, TX). , Perryton, TX 79070 Phone (806)435-8000 Fax (806)435-8011. 01 PREA Zero Tolerance Policy 400-12. Look up the offender's criminal charges 4. Find Ochiltree county, TX jails and other correctional facilities online. Employees Only. Ochiltree County Sheriffâs Office Terry Bouchard, Sheriff 21 SE 6th Ave Perryton, TX 79070 Phone: (806) 435-8000 Fax: (806) 435-8011 txsheriff@ochiltree. There were two arrests on Tuesday, October 1. 5 square miles is water. Preview document images, or purchase to download high quality PDF copies. Friday. Call the Ochiltree County Jail at 806-435-8000 3. Nueces County Jail is located in Nueces County, Texas. Other Jails & Prisons Nearby. Overland El Paso, Texas 79901 (915) 273-3520; Fax (915) 273-3858 Ochiltree County Jail Report. Sunday, October 13, there was one arrest. Sheriff Ochiltree County Sheriff 21 SE 6th St. Juan Constante, 67, was arrested for public intoxication. net. ADA Policy /QuickLinks. Video Visitation at Ochiltree County Jail. All incoming Inmate mail will be opened and inspected for contraband, but not read. Edinburg, Texas 78539. c/o Peoria County Jail 301 N. This establishment, which can accommodate up to 32 inmates, is overseen by the Ochiltree County Sheriffs Office. such as jail records. Perryton, TX. Over the past 45 years, the incarceration rate in OCHILTREE County has increased by 79% going from 14 inmates yearly to 25 inmates. Keeping yourself or your family safe is the most important thing. There was one arrest on Saturday, October 12. inmate Search links for Ochiltree Find Marriage Records from Ochiltree County, Texas Public & Vital Records Index with Birth, Divorce, Death, Obituary, Census, Court, Land, Military Records. Upload your own photos and videos. Or you can use the above search form to search through an online criminal records database instantly. LOYA,ARTURO JUNIOR | 2025-03-18 Ochiltree County, Texas Booking Booking Details name LOYA,ARTURO JUNIOR age 22 years old height 6â00â hair BLK eye BRO weight 250sex Arrests. The physical location of the Nueces County Jail is: Nueces County Jail 901 Leopard St. , 24, was arrested on a warrant for DWI â bond increase. Cora Amado, 32, was arrested for assault. Look up photos of the Ochiltree County Jail in TX. DIRECTORY. S. Tax Rates. Pedro Guardado Marquez, 29, was arrested for DWI. Ash Perryton About. Procedures for Public Access & Complaints; Ochiltree County TNT Worksheets. Main Perryton, TX 79070 Phone: 806-435-8054 Fax: 806-435-8058 Email: sbogard@ochiltree. Sitemap For general custody related questions and help with inmate location, call: (213) 473-6100 For Healthcare Concerns which require immediate assistance, please call the medical command center at: (213) 893-5544 The Simplest Way to Search for Ochiltree County Warrants and Arrest Records. Criminal Records and Contact Info Inmate Records in Ochiltree County (Texas) Find complete inmate records for Ochiltree County, TX, including court records, arrest records, mugshots, and detailed inmate information. Israel Ramirez, 40, was arrested on a warrant for assault causes bodily injury and a warrant for interfering with an emergency request. The physical location of the Henderson County Jail is: Henderson County Jail 206 N Murchison St, Athens, TX 75751 Phone: (903) 677-6322 Birth certificates, marriage and death certificates, and more on Ochiltree County vital records; Marriage applications, licenses, and records; Voter registration, polls, and elections; Early arangements in terms of booking with the Ochiltree clerk is always of essense â it helps save time and your issue will be addressed promptly. The Harris County Sheriff's Office, founded in 1837, is the largest sheriff's office in Texas and the third-largest in the nation. Mineral, utility, industrial and personal property accounts are appraised for the district by Pritchard & Abbott, Looking for Perryton Police Department arrests, warrants & records? Quickly find Police phone number, directions & services (Perryton, TX). CV15449, Ochiltree County Appraisal District v. 2. There was one arrest on Wednesday, July 31. Saturday, July 9, there were two arrests. Hemphill County Probation Department PO Box 1322, Canadian, TX - 40. Ochiltree County Jail allows inmates to receive money from their families, friends, and loved ones. Recorder, Clerk, Marriage Licenses, Birth, Death and Marriage Records, and Voter Information. Frequently Asked Questions. It is updated once per Ochiltree County Jail Report. fvrbgjicjfecyzedavftyamcideyydpzylnnedcsyritrfcwwyqgeimwiwayvvhpiuvkdwj